PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009597063.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family CO-like
Protein Properties Length: 390aa    MW: 43151.5 Da    PI: 6.3995
Description CO-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009597063.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box16.61.6e-05242337
        zf-B_box  3 erkCpeHeekelqlfCedCqqllCedClleeHkg......H 37
                    e+ C+ ++ +++  +C+++   lC  C  + H+       H
  XP_009597063.1  2 EPLCDVCGVERAVVYCKSDAAKLCFPCDGSVHSAnclsrkH 42
                    689*************************9999545555555 PP

2CCT60.94.3e-21334377144
             CCT   1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkqa 44 
                     R++a++RY+eK+ktR F K+irY+sRK++A++R RvKGrFvk+ 
  XP_009597063.1 334 RNEAKMRYNEKKKTRTFRKQIRYASRKVRADTRRRVKGRFVKAG 377
                     99***************************************985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS501199.3147IPR000315B-box-type zinc finger
SMARTSM003368.8E-11147IPR000315B-box-type zinc finger
CDDcd000211.57E-5347No hitNo description
PROSITE profilePS5101714.495334376IPR010402CCT domain
PfamPF062038.8E-16334376IPR010402CCT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005622Cellular Componentintracellular
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 390 aa     Download sequence    Send to blast
MEPLCDVCGV ERAVVYCKSD AAKLCFPCDG SVHSANCLSR KHVRSLICDN CSSEPAIVRC  60
MIIVMCLCEG CDSNTIGCNM VSRHQHQKLD SYSGCPSPAE FMTKILSTTF DQMPNNNVHN  120
VSSFDTTSSL SVNENNCSMV ASKLNELASC MKFKPWGIPS NSTYLTTYNI DQAPFFSEGS  180
SLPKQSCTTI KDHGIYGGDD LAEGVDLDEL SSDCSYNIFS SLQQSHSRYY SEDRGLDCLI  240
MEKNLSVIGP NSHVETALEA PCSVSGTANS MFMNQSCNGD TGLAFTQGPV HSRSLSISNI  300
TTESSEATDY QDCGFSPLFP PCDWNSETSC VRARNEAKMR YNEKKKTRTF RKQIRYASRK  360
VRADTRRRVK GRFVKAGEAY DFDPLVTRDM
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754448e-32HG975444.1 Solanum pennellii chromosome ch05, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009597063.10.0PREDICTED: zinc finger protein CONSTANS-LIKE 12-like
TrEMBLA0A103XTK51e-125A0A103XTK5_CYNCS; CCT domain-containing protein
STRINGSolyc05g046040.1.11e-124(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA42311726
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G21880.12e-75B-box type zinc finger protein with CCT domain